PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g088820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 794aa    MW: 89802.7 Da    PI: 8.1293
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g088820.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B331.92.4e-1021911293
                    HTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3 12 ksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93
                     ++ +++p +f+ ++  gg+     +++  d s r+W+vk+  ++++    +t+GW+eF  an  + gD+v+ +++g+s f  +
  Csa09g088820.1 21 HTH-FTIPEDFFLKYveGGSV---AEVK-SDVSDRTWQVKM--SGRR----FTDGWEEFTVANYFRIGDVVLVRYVGDSVF--H 91
                    444.99******999753332...2455.77999*******..7776....9************************99888..4 PP

2B356.45.5e-18160251396
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                       l+++ +l+++ l+lp +f++++ +   + ++++l+d + rsW + l ++ +s+++++++GW++F+++ng k+g f++F+l+g +++++v+++
  Csa09g088820.1 160 VLLVTALNLRTDKLYLPLHFTSSNCLTR-KCREIVLTDGKERSWALDLGFDESSDTFYISRGWRSFCDENGQKAGGFFMFQLVG-NGETPVLSL 251
                     56778889999*************6664.557**************************************************99.555577766 PP

3B345.41.5e-14327406186
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                     f+k ++p+++ k g l++  +f++e+g+k+    ++ l d++gr+W  +l    ++g++ l+kGWk+Fvkan L++g +  +kl++
  Csa09g088820.1 327 FIKFTLPPYYDKIGKLSVVAPFVRENGIKPG---EIFLLDKDGRRWLTNL-LLDCRGTMALGKGWKDFVKANSLESGFT--LKLIW 406
                     89999*********************98864...6***************.577777899***************9955..44446 PP

4B366.24.8e-21581673399
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     + +++++  k++rlvl+ +fa++++++k++  t+ l d++g +W  kl +r + g++ l++GWkeF+kan+ k+gD+++ +l++ ++++++++++
  Csa09g088820.1 581 TLTITPSGVKNCRLVLSAQFARDNNINKPG--TIYLLDTDGTKWLTKL-HRDSIGKMSLGEGWKEFAKANDFKQGDSFTMELIW-EDTTPMLSLL 671
                     56789999****************999766..8***************.56666669***************************.8888999999 PP

                     -S CS
              B3  98 rk 99 
                     rk
  Csa09g088820.1 672 RK 673
                     87 PP

5B351.41.9e-16707793495
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     +ltp+dv +s+ l+lp +f++++g++     ++tl +e+g +W+ +l    ++g++ l+ GWk+F++ang++ g+ ++++++++++++++vk
  Csa09g088820.1 707 ALTPEDVKASK-LILPSQFMKANGINRL--GKITLLSENGMEWSGYL--LTRDGTVALGCGWKGFCEANGVQLGEPFTLEFINKQDTTPMVK 793
                     58999999998.***********99844..48***************..99999****************************9999999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.9E-14797IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.08998IPR003340B3 DNA binding domain
SuperFamilySSF1019365.69E-149102IPR015300DNA-binding pseudobarrel domain
CDDcd100173.91E-91093No hitNo description
SMARTSM010199.5E-151298IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.5E-18150251IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.1E-19154254IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.706158254IPR003340B3 DNA binding domain
CDDcd100174.02E-14158253No hitNo description
SMARTSM010199.0E-24158255IPR003340B3 DNA binding domain
PfamPF023629.9E-17159251IPR003340B3 DNA binding domain
SuperFamilySSF1019361.22E-12324416IPR015300DNA-binding pseudobarrel domain
CDDcd100177.95E-13325417No hitNo description
SMARTSM010191.5E-21327419IPR003340B3 DNA binding domain
PROSITE profilePS5086311.279327419IPR003340B3 DNA binding domain
PfamPF023629.8E-13327416IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.0E-13331415IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.7E-9443522IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-9449523IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0041453544IPR003340B3 DNA binding domain
CDDcd100177.20E-8453520No hitNo description
Gene3DG3DSA:2.40.330.103.7E-25569673IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.69E-21575673IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.3E-26579674IPR003340B3 DNA binding domain
CDDcd100171.53E-19579672No hitNo description
PROSITE profilePS5086315.072579674IPR003340B3 DNA binding domain
PfamPF023622.0E-19580673IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-16698786IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-17699785IPR015300DNA-binding pseudobarrel domain
SMARTSM010194.2E-14703790IPR003340B3 DNA binding domain
PROSITE profilePS5086313.606703793IPR003340B3 DNA binding domain
PfamPF023625.9E-15708793IPR003340B3 DNA binding domain
CDDcd100172.23E-12708793No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 794 aa     Download sequence    Send to blast
MATTSRVHHP QFFHTLVPGF HTHFTIPEDF FLKYVEGGSV AEVKSDVSDR TWQVKMSGRR  60
FTDGWEEFTV ANYFRIGDVV LVRYVGDSVF HVSDLGPNHS EIQDNDEGKK RLHQVEFSSN  120
NEDGDDDEEL PREKRARKNS EGAEAVSSSS SSADDNSCFV LLVTALNLRT DKLYLPLHFT  180
SSNCLTRKCR EIVLTDGKER SWALDLGFDE SSDTFYISRG WRSFCDENGQ KAGGFFMFQL  240
VGNGETPVLS LYPTESISDR RQRDCSEASK RESVATKLSS VEENIAREGS KDECSSPESL  300
MDIEKRKSIL KPRDSPYSSY SPCHKRFIKF TLPPYYDKIG KLSVVAPFVR ENGIKPGEIF  360
LLDKDGRRWL TNLLLDCRGT MALGKGWKDF VKANSLESGF TLKLIWEETI PVLSLCCAES  420
NNDRELEEFL KAIEKKKSHL KWRDSTPSSR KQFVTLTITP YSVENSILRL SMTFTRVNDI  480
KPGIVTLLGK DGIKHQTNLL LDKTCGRMAF GKGWKDFVKE CSIGREATNQ KKSLPIEPST  540
CKKISKDKNI KHDNSKEKNN KEERRSVDRE RNQSRQTQYV TLTITPSGVK NCRLVLSAQF  600
ARDNNINKPG TIYLLDTDGT KWLTKLHRDS IGKMSLGEGW KEFAKANDFK QGDSFTMELI  660
WEDTTPMLSL LRKEFSSSKS NKEESIFSEP KNRDSSPTIE NRLVTLALTP EDVKASKLIL  720
PSQFMKANGI NRLGKITLLS ENGMEWSGYL LTRDGTVALG CGWKGFCEAN GVQLGEPFTL  780
EFINKQDTTP MVK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1434438KKKSH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0069542e-80AC006954.8 Arabidopsis thaliana chromosome 2 clone F25P17 map mi238, complete sequence.
GenBankCP0026852e-80CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010472478.10.0PREDICTED: B3 domain-containing protein REM13-like
SwissprotP0CAP50.0REM13_ARATH; B3 domain-containing protein REM13
TrEMBLV4NJI60.0V4NJI6_EUTSA; Uncharacterized protein
STRINGAT2G24650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137801326
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24650.10.0DNA binding;DNA binding;sequence-specific DNA binding transcription factors